Cat: PA1000-4919

Recombinant Human PSG2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSG2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSG2;PSBG2;Pregnancy-specific beta-1-glycoProtein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11465

  • Expression Region

    35-335aa

  • AA Sequence

    QVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYITSYVV DGQIIIYGPAYSGRE TAYSNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTFTLYLETPKP SISSSNLNPREAMET VILTCDPETPDTSYQWWMNGQSLPMTHRFQLSETNRTLFLFGVTKYTAGP YECEIRNSGSASRSD PVTLNLLHGPDLPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKF QQSGQNLFIPQITTK HSGLYVCSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPTVDHHHHHH

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSG2, or pregnancy-specific glycoprotein 2, is a member of the pregnancy-specific glycoprotein (PSG) family, which is primarily expressed in the placenta during pregnancy. Research on PSG2 has gained significance due to its potential roles in immunomodulation, fetal development, and its association with various pregnancy-related complications. In early pregnancy, PSG2 may facilitate the mother’s immune tolerance towards the semi-allogeneic fetus, promoting a successful gestation. Additionally, abnormal levels of PSG2 have been linked to conditions such as pre-eclampsia and intrauterine growth restriction, making it a potential biomarker for monitoring pregnancy health. The recombinant form of PSG2 is being studied for its structural and functional properties, which may shed light on its mechanistic roles in maternal-fetal interactions. Understanding the molecular functions of PSG2 could lead to novel therapeutic strategies for managing pregnancy complications and enhancing pregnancy outcomes. Furthermore, PSG2 may hold promise in developing diagnostic tools for early detection of pregnancy-related disorders, emphasizing the importance of ongoing research in this area. Thus, the study of PSG2 and its recombinant protein not only contributes to our understanding of placental biology but also opens avenues for medical advancements in reproductive health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US