Cat: PA1000-4918

Recombinant Human IL-5Rα Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-5Rα

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL-5Rα

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q01344

  • Expression Region

    21-335aa

  • AA Sequence

    DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKIN APKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYF LYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSK HSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCF DYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAG LWSEWSQPIYVGNDE

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-5 receptor alpha (IL-5Rα) is a key component of the interleukin-5 (IL-5) signaling pathway, which plays a crucial role in the maturation, activation, and survival of eosinophils, a type of white blood cell involved in allergic responses and asthma. Elevated levels of IL-5 and its receptor have been implicated in various allergic disorders, making IL-5Rα a significant target for therapeutic interventions. Understanding the structure and function of IL-5Rα is essential for developing monoclonal antibodies and other biologics aimed at modulating eosinophilic activity. Recombinant IL-5Rα proteins have been generated for research purposes, allowing scientists to explore its interactions with IL-5 and potential signaling mechanisms further. These studies contribute to the identification of novel pathways and mechanisms involved in eosinophilic diseases, ultimately leading to innovative treatment options for conditions such as asthma, eosinophilic esophagitis, and chronic rhinosinusitis. The ongoing research into IL-5Rα and its role in immune responses highlights the importance of targeting eosinophils to ameliorate allergic and inflammatory diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US