Cat: PA2000-2086

Recombinant Human MAGEA10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAGEA10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MAGEA10;MAGE10;Melanoma-associated antigen 10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P43363

  • Expression Region

    1-369aa

  • AA Sequence

    MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPS SFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASL PLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQ MKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHS FVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEAL NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP RAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDD TTAMASASSSATGSFSYPE

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAGEA10 is a member of the MAGE (Melanoma Antigen Gene) family, which consists of a group of genes primarily expressed in melanoma and other cancers. Characterized by its tumor-specific expression, MAGEA10 has garnered attention for its potential role in cancer immunotherapy and as a biomarker for cancer diagnosis and prognosis. Research has shown that MAGEA10 is involved in regulating cellular processes such as apoptosis and proliferation, making it a potential target for therapeutic interventions. The interest in MAGEA10 is further heightened by its ability to elicit immune responses, indicating that it may serve as an effective target for cancer vaccines. This has led to the production of recombinant MAGEA10 proteins for use in various studies aimed at understanding its functions and developing targeted therapies. Researchers are exploring the structural and functional properties of the MAGEA10 protein to evaluate its immunogenic potential and efficacy in therapeutic applications. As the field of cancer immunotherapy rapidly evolves, the investigation of MAGEA10 presents a promising avenue for advancing treatment strategies, potentially improving outcomes for patients afflicted with malignancies where this antigen is upregulated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US