Analytical Data
-
Gene name
LAMTOR3
- Application
-
Alternative Names
LAMTOR3；MAP2K1IP1；MAPKSP1；Ragulator complex Protein LAMTOR3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHA4
-
Expression Region
1-124aa
-
AA Sequence
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
-
Molecular Weight
40.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMTOR3, or late endosomal/lysosomal adaptor and MAPK-binding protein 3, plays a crucial role in the endocytic pathway, particularly in the regulation of nutrient sensing and mTOR signaling. Its interaction with various signaling molecules underscores its importance in cellular processes such as growth, metabolism, and autophagy. Research has shown that LAMTOR3 is integral in mediating the cellular response to growth factors and nutrients, thereby influencing protein synthesis and cell proliferation. Abnormalities in LAMTOR3 expression or function may contribute to various diseases, including cancer and metabolic disorders. Understanding the mechanistic role of LAMTOR3 in these pathways is vital for elucidating its potential as a therapeutic target. Recent studies have focused on characterizing the structure and function of LAMTOR3, as well as its interactions with other LAMTOR complex members, to gain deeper insights into its role in cellular homeostasis and disease. This growing body of research highlights the significance of LAMTOR3 in maintaining cellular functions and its promise as a focal point for developing new strategies in disease intervention and treatment.
