Analytical Data
-
Gene name
ATP9B
- Application
-
Alternative Names
ATP9B; ATPIIB; NEO1L; HUSSY-20; Probable phospholipid-transporting ATPase IIB
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43861
-
Expression Region
1-136aa
-
AA Sequence
MPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLMT
-
Molecular Weight
42.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP9B, a member of the ATP-binding cassette (ABC) transporter superfamily, is an essential protein implicated in various cellular processes, including lipid metabolism and protein quality control. Recent studies have shown that ATP9B plays a crucial role in the intracellular transport of phospholipids, particularly in the maintenance of plasma membrane integrity and the regulation of cell signaling pathways. Its dysfunction has been linked to several diseases, including cancer and neurodegenerative disorders, highlighting its potential as a biomarker and therapeutic target. The recombinant expression of ATP9B allows for detailed biochemical and biophysical characterization, facilitating the understanding of its structural and functional properties. Furthermore, the ability to produce ATP9B in a controlled recombinant system opens up avenues for investigating its interactions with other cellular components and exploring the mechanisms by which it contributes to disease pathogenesis. Ongoing research in this area aims to elucidate the therapeutic implications of modulating ATP9B activity, which could lead to innovative strategies for treating diseases associated with its dysfunction. Understanding ATP9B through recombinant techniques will not only enhance our fundamental knowledge of its role in cellular homeostasis but also potentially pave the way for novel interventions in diseases driven by dysregulated lipid transport and metabolism.
