Analytical Data
-
Gene name
ABHD6
- Application
-
Alternative Names
ABHD6；Monoacylglycerol lipase ABHD6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BV23
-
Expression Region
1-337aa
-
AA Sequence
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQV RYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHL VCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMG GQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKI PLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEI VSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
-
Molecular Weight
65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABHD6 (Alpha/Beta Hydrolase Domain Containing 6) is a serine hydrolase that has garnered significant interest in the field of biomedical research due to its role in lipid metabolism and neurobiology. Initially identified as a brain-specific enzyme, ABHD6 is involved in the hydrolysis of monoacylglycerols, which are critical signaling lipids in the endocannabinoid system. Dysregulation of this pathway has been linked to various neurological disorders, including anxiety, depression, and neurodegenerative diseases. Additionally, ABHD6 has been shown to play a role in inflammation and insulin sensitivity, making it a potential target for metabolic disorder therapies. Recent studies employing recombinant protein technology have facilitated the detailed characterization of ABHD6’s enzymatic activity, substrate specificity, and regulatory mechanisms. By producing and purifying ABHD6 as a recombinant protein, researchers aim to elucidate its biological functions and interactions at the molecular level. This knowledge could pave the way for novel therapeutic strategies targeting ABHD6 in treating diseases associated with endocannabinoid dysregulation, highlighting its importance in drug discovery and development. Overall, the study of ABHD6 recombinant protein continues to provide insights into its multifaceted roles in human health and disease.
