Analytical Data
-
Gene name
ASB15
- Application
-
Alternative Names
ASB15Ankyrin repeat and SOCS box Protein 15; ASB-15
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXK1
-
Expression Region
1-588aa
-
AA Sequence
MDTNDDPDEDHLTSYDIQLSIQESIEASKTALCPERFVPLSAQNRKLVEAIKQGHIPELQEYVKYKYAMDEADEKGWFPLHEAVVQPIQQILEIVLDASYKTLWEFKTCDGETPLTLAVKAGLVENVRTLLEKGVWPNTKNDKGETPLLIAVKKGSYDMVSTLIKHNTSLDQPCVKRWSAMHEAAKQGRKDIVALLLKHGGNVHLRDGFGVTPLGVAAEYGHCDVLEHLIHKGGDVLALADDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHLPIHRAAYEGHYLALKYLIPVTSKNAIRKSGLTPIHSAADGQNAQCLELLIENGFDVNTLLADHISQSYDDERKTALYFGVSNNDVHCTEVLLAAGADPNLDPLNCLLVAVRANNYEIVRLLLSHGANVNCYFMHVNDTRFPSVIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSEIQEEVLPGWTSCVIKDNPFCEFITVPWMKHLVGRVTRVLIDYMDYVPLCAKLKSALEVQREWPEIRQILENPCSLKHLCRLKIRRLMGLQKLCQPASVEKLPLPPAIQRYILFKEYDLYGQELKLT
-
Molecular Weight
64.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASB15, or Ankyrin Repeat and SOCS Box-containing Protein 15, is a member of the ASB family, which plays a crucial role in mediating protein-protein interactions and regulating various cellular processes, including signal transduction and protein degradation through the ubiquitin-proteasome pathway. Research into ASB15 has gained attention due to its potential involvement in several biological processes, particularly in immune response and inflammation. Its unique structure, featuring ankyrin repeat motifs that facilitate interaction with target proteins, positions ASB15 as a significant player in the regulation of cellular signaling pathways. Recent studies suggest that ASB15 may influence the stability and activity of key signaling molecules, thereby impacting cellular responses to various stimuli. Additionally, aberrant expression levels of ASB15 have been linked to certain diseases, including cancer and autoimmune disorders, highlighting its potential as a biomarker or therapeutic target. Understanding the function and mechanisms of ASB15 is critical for unraveling its role in health and disease, paving the way for future research aimed at exploring its therapeutic implications and enhancing our knowledge of protein regulation in cellular contexts.
