Analytical Data
-
Gene name
UBLCP1
- Application
-
Alternative Names
UBLCP1；Ubiquitin-like domain-containing CTD phosphatase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVY7
-
Expression Region
1-318aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMALPIIVKWGGQEYSVTTLSEDDTVLD LKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGT REESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKV EILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDY DIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLI DVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLN RDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBLCP1, or Ubiquitin-like Containing PHD and RING Finger Domains 1, has garnered significant attention in recent years due to its potential role in various biological processes, particularly in the regulation of cellular responses to stress and development. Initially identified as a protein associated with the ubiquitin-proteasome system, UBLCP1 is believed to play a crucial role in modulating protein stability and degradation, thereby affecting various signaling pathways. Research indicates that UBLCP1 is involved in tumorigenesis and inflammatory responses, making it a potential target for therapeutic interventions in cancer and autoimmune disorders. Studies also suggest that the protein may interact with chromatin-modifying complexes, influencing gene expression and cellular differentiation. As the understanding of post-translational modifications expands, UBLCP1's complex role in integrating molecular signaling networks continues to be a focal point of investigation. The characterization of UBLCP1 recombinant proteins provides valuable insights into its functional mechanisms, enabling potential applications in drug development and personalized medicine. Overall, the study of UBLCP1 is pivotal not only for elucidating its biological significance but also for exploring its therapeutic potential in treating diseases characterized by dysregulated protein homeostasis and cellular signaling pathways.
