Analytical Data
-
Gene name
PDE6G
- Application
-
Alternative Names
Retinal rod rhodopsin-sensitive cGMP 3'.5'-cyclic phosphodiesterase subunit gamma. GMP-PDE gamma. EC:3.1.4.35
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18545
-
Expression Region
1-87 aa
-
AA Sequence
MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
-
Molecular Weight
35.97 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Phosphodiesterase 6 gamma subunit (PDE6G) is a crucial component of the phototransduction cascade in retinal photoreceptor cells, where it plays a vital role in activating phosphodiesterase 6 (PDE6) to regulate cyclic GMP levels and facilitate visual signal processing. Mutations in the PDE6G gene have been implicated in various forms of retinal diseases, including retinitis pigmentosa and congenital stationary night blindness, leading to vision impairment or loss. Research on recombinant PDE6G proteins has gained momentum due to their potential applications in understanding the molecular mechanisms underlying these retinal disorders and developing therapeutic strategies. By producing and characterizing recombinant PDE6G, scientists can explore its biochemical properties, interaction with other proteins in the phototransduction cascade, and the effects of specific mutations. This knowledge is essential for unraveling the complex biology of vision and may pave the way for gene therapy approaches, protein replacement strategies, or pharmacological interventions aimed at restoring visual function in affected individuals. Thus, the study of PDE6G recombinant proteins not only enhances our fundamental understanding of retinal biochemistry but also opens up new avenues for innovative treatments for retinal degenerative diseases.
