Cat: PA1000-3385

Recombinant Human UBE2W Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UBE2W

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UBE2W;UBC16;Ubiquitin-conjugating enzyme E2 W

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96B02

  • Expression Region

    1-151aa

  • AA Sequence

    MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

  • Molecular Weight

    33.3kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UBE2W, a member of the ubiquitin-conjugating enzyme family, plays a crucial role in the ubiquitin-proteasome pathway, which is essential for various cellular processes including protein degradation, cell cycle regulation, and DNA repair. Unlike other E2 enzymes, UBE2W is particularly notable for its ability to promote the ubiquitination of substrates in a manner that is essential for the regulation of cellular responses to stress and for maintaining protein homeostasis. Research has indicated that UBE2W’s activity is tightly regulated, and its dysregulation is associated with several diseases, including cancer and neurodegenerative disorders. Understanding the structural and functional aspects of UBE2W can provide insights into its specific mechanisms of action and its interactions with various E3 ligases and substrates. Recent studies have focused on the development and characterization of recombinant UBE2W proteins to further elucidate its role in ubiquitination processes. By utilizing techniques such as X-ray crystallography and mutagenesis, researchers aim to identify critical residues involved in its enzymatic activity and to explore potential therapeutic targets for diseases linked to UBE2W dysfunction. As the field of proteostasis continues to grow, the study of UBE2W presents a promising avenue for discovering novel interventions that could ameliorate the effects of diseases resulting from protein misregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US