Analytical Data
-
Gene name
FOXI1
- Application
-
Alternative Names
FOXI1；FKHL10；FREAC6；Forkhead box Protein I1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12951
-
Expression Region
1-283aa
-
AA Sequence
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFE GGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVS GLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIY QYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPT SHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNM LSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV
-
Molecular Weight
57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOXI1, a member of the Forkhead box (Fox) transcription factor family, plays a crucial role in regulating various physiological processes, including development, differentiation, and metabolism. Research has highlighted FOXI1's significant involvement in epithelial cells, particularly in the context of salivary gland development and function, as well as its role in the regulation of chloride channels. Its expression has been linked to various diseases, including congenital disorders and cancers. Understanding the structure and function of FOXI1 is critical for elucidating its mechanisms of action and potential therapeutic applications. The production of recombinant FOXI1 proteins enables researchers to study its biochemical properties, binding affinities, and interactions with other cellular components in a controlled laboratory setting. This recombinant approach facilitates detailed investigations into FOXI1's regulatory pathways and its role in gene expression modulation, ultimately contributing to a broader understanding of its significance in health and disease. As a result, FOXI1 recombinant protein research is a promising field with implications for both basic science and medical advancements.
