Analytical Data
-
Gene name
UBE2V2
- Application
-
Alternative Names
UBE2V2；BLU；Ubiquitin-conjugating enzyme E2 N
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15819
-
Expression Region
2-145aa
-
AA Sequence
AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
-
Molecular Weight
32.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBE2V2, a member of the ubiquitin-conjugating enzyme family, plays a crucial role in the ubiquitin-proteasome system, which is essential for protein degradation and the regulation of various cellular processes. It is particularly involved in the modification of proteins via ubiquitination, impacting processes such as cell cycle regulation, apoptosis, and DNA repair. Recent studies have highlighted the significance of UBE2V2 in cancer biology, as its dysregulation can lead to uncontrolled cell proliferation and tumor progression. Additionally, UBE2V2 has been implicated in the modulation of immune responses and the maintenance of cellular homeostasis. Research on recombinant UBE2V2 proteins has provided insights into its structural characteristics, enzymatic activity, and interaction with substrate proteins and other E3 ligases. These studies are essential for understanding the molecular mechanisms underlying UBE2V2's function and its potential as a therapeutic target in cancer and other diseases. The development of recombinant UBE2V2 proteins facilitates the investigation of its biochemical properties and the elucidation of its role in cellular signaling pathways, thereby contributing to the broader field of ubiquitin research and its implications in health and disease.
