Analytical Data
-
Gene name
ARSK
- Application
-
Alternative Names
arsk; ARSK_HUMAN; arylsulfatase family member K; Arylsulfatase K; Arylsulfatase K precursor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UWY0
-
Expression Region
1-536aa
-
AA Sequence
MLLLWVSVVAALALAVLAPGAGEQRRRAAKAPNVVLVVSDSFDGRLTFHPGSQVVKLPFINFMKTRGTSFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSISNRVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMERDWQNTDKAVNWLRKEAINYTEPFVIYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQVSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLRTNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVKFPEITYSLDQKLHSIINYPKVSASVHQYNKEQFIKWKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQWLKTHMNPRAV
-
Molecular Weight
87.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARSK (AMPK-related Serine/Threonine Kinase) is a relatively newly identified enzyme that plays a critical role in various cellular processes, including energy metabolism, cell growth, and differentiation. Its unique structural features and regulatory mechanisms make ARSK a significant focus in the field of biochemical research. The interest in ARSK has surged due to its potential implications in metabolic disorders and cancer. Researchers have been investigating ARSK's molecular functions, substrate specificity, and interaction with other signaling pathways to better understand its roles in cellular physiology. Recombinant ARSK proteins are essential tools for these studies, allowing scientists to explore the enzyme's activity and function in controlled environments. By producing and characterizing ARSK in a laboratory setting, researchers aim to unravel the complexities of its regulation and its impacts on health and disease. Overall, the investigation of ARSK through recombinant protein studies is expected to contribute to the development of novel therapeutic strategies for metabolic diseases and cancers that involve dysregulation of cellular signaling pathways.
