Cat: PA1000-3380

Recombinant Human UBE2Q2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UBE2Q2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UBE2Q2;Ubiquitin-conjugating enzyme E2 Q2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WVN8

  • Expression Region

    1-375aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSVSGLKAELKFLASIFDKNHERFRIV SWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDP NLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPT GQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEK ENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIY SVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDN FPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQIN ATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UBE2Q2, a member of the Ubiquitin-conjugating enzyme (E2) family, plays a critical role in the ubiquitin-proteasome system, which is essential for protein degradation and regulation of various cellular processes. Research has shown that UBE2Q2 is involved in the ubiquitination of substrates linked to cell cycle regulation, DNA damage response, and apoptosis. Dysregulation of this enzyme has been implicated in various diseases, including cancer and neurodegenerative disorders. Given its pivotal role, studying UBE2Q2 at the molecular level can provide insights into its function and regulation, and potentially unveil new therapeutic targets. The development and characterization of recombinant UBE2Q2 proteins have facilitated exploration of its biochemical properties, substrate specificity, and interaction with E3 ligases. Furthermore, understanding the structural features of UBE2Q2 can shed light on its mechanism of action and involvement in pathogenic processes. Overall, this research is crucial for elucidating the role of UBE2Q2 in health and disease, potentially leading to novel strategies for intervention in related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US