Analytical Data
-
Gene name
UBE2L6
- Application
-
Alternative Names
UBE2L6;UBCH8;Ubiquitin/ISG15-conjugating enzyme E2 L6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14933
-
Expression Region
1-153aa
-
AA Sequence
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKA FNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTK TCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVD RPS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBE2L6, a member of the ubiquitin-conjugating enzyme (E2) family, plays a crucial role in the ubiquitin-proteasome pathway, a fundamental cellular mechanism responsible for protein degradation and regulation. This enzyme is primarily involved in the ubiquitination process, which tags proteins for degradation or alters their function, thereby influencing various biological processes including cell cycle regulation, DNA repair, and signal transduction. Research into UBE2L6 has garnered interest due to its implications in various diseases, including cancers and neurodegenerative disorders. Abnormalities in ubiquitination processes, which can arise from dysfunction in E2 enzymes like UBE2L6, are associated with the accumulation of damaged or misfolded proteins, leading to cellular stress and disease progression. Furthermore, UBE2L6 has been shown to interact with multiple substrates, highlighting its potential as a therapeutic target. Understanding its structure, enzymatic activity, and interactions with E3 ligases is essential for uncovering its biological functions and potential roles in disease mechanisms. Recent studies have utilized recombinant protein technology to produce UBE2L6 for in vitro analyses, providing insights into its biochemical properties and facilitating drug discovery efforts aimed at modulating its activity for therapeutic benefits. Thus, the investigation of UBE2L6 recombinant protein continues to be a vibrant area of research with promising implications for understanding and treating diseases linked to protein homeostasis.











