Analytical Data
-
Gene name
PCSK4
- Application
-
Alternative Names
PCSK4; PC4; UNQ2757/PRO6496; Proprotein convertase subtilisin/kexin type 4; Proprotein convertase 4; PC4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UW60
-
Expression Region
1-242 aa
-
AA Sequence
MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
-
Molecular Weight
52.36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PCSK4, or proprotein convertase subtilisin/kexin type 4, is an important enzyme involved in the post-translational modification of various precursor proteins, playing a crucial role in numerous biological processes, including hormone signaling and embryonic development. Understanding PCSK4 is particularly vital due to its involvement in reproductive physiology and potential implications in human diseases, such as infertility and certain cancers. Research has indicated that PCSK4 may influence the processing of prohormones and other substrates critical for reproductive function, making it a target of interest for both basic and applied biomedical research. The recombinant production of PCSK4 protein allows for detailed biochemical analysis, including substrate specificity, enzyme kinetics, and interaction studies, which can elucidate its role in physiological and pathological contexts. Furthermore, the availability of recombinant PCSK4 can facilitate the development of therapeutic strategies aimed at modulating its activity for therapeutic purposes, highlighting its significance in clinical research. Thus, study of PCSK4 through its recombinant protein is essential not only for understanding its fundamental biological roles but also for exploring its potential as a target for novel therapeutic interventions.
