Analytical Data
-
Gene name
UBD
- Application
-
Alternative Names
UBD；FAT10；Ubiquitin D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15205
-
Expression Region
1-165aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAPNASCLCVHVRSEEWDLMTFDANPY DSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLT LKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIP ETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBD (Ubiquitin-like Domain) proteins play a crucial role in various cellular processes, including protein degradation, signal transduction, and responses to stress and environmental changes. These proteins are characterized by their ability to mimic ubiquitin, a small protein that modifies target proteins through post-translational modification, thereby influencing their stability, localization, and activity. The study of UBD proteins has gained significant attention due to their involvement in crucial biological pathways and their potential implications in diseases, such as cancer and neurodegeneration. Research has focused on understanding the molecular mechanisms by which UBD proteins interact with other cellular components and regulate protein function. Additionally, the discovery of novel UBD proteins and their associated pathways opens new avenues for therapeutic interventions. By leveraging advanced techniques in molecular biology and proteomics, scientists aim to elucidate the roles of UBD proteins in health and disease, paving the way for innovative strategies in drug development and disease management. The ongoing research in this field not only enhances our understanding of cellular dynamics but also underscores the interconnectedness of ubiquitination pathways with UBD proteins, highlighting their potential as biomarkers and therapeutic targets.
