Analytical Data
-
Gene name
ARMC7
- Application
-
Alternative Names
ARMC7Armadillo repeat-containing Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6L4
-
Expression Region
1-198aa
-
AA Sequence
MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR
-
Molecular Weight
48.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARMC7, or Armadillo Repeat Containing 7, is a protein that has garnered significant interest in recent years due to its potential roles in various biological processes and diseases. This protein is part of the armadillo repeat domain family, which is known to facilitate protein-protein interactions and is crucial for cellular signaling, adhesion, and transcriptional regulation. Research has suggested that ARMC7 may be involved in developmental processes and is implicated in the pathology of certain cancers and neurodegenerative disorders. The exploration of ARMC7's structural characteristics, expression patterns, and functional roles is vital for understanding its biological significance. Through the study of ARMC7 recombinant protein, researchers aim to elucidate its mechanism of action, interactions with other cellular components, and potential as a therapeutic target. Recent advances in recombinant DNA technology and protein expression systems have made it feasible to produce ARMC7 in sufficient quantities for detailed studies, enabling scientists to investigate its biochemical properties and potential applications in disease modeling and drug discovery. The ongoing research into ARMC7 may provide insights into novel therapeutic strategies and enhance our understanding of complex cellular processes.
