Analytical Data
-
Gene name
ANKRD37
- Application
-
Alternative Names
ANKRD37; Ankyrin repeat domain 37; Ankyrin repeat domain containing Protein 37
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z713
-
Expression Region
1-158aa
-
AA Sequence
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
-
Molecular Weight
43.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANKRD37, a member of the ankyrin repeat domain-containing protein family, has garnered attention in recent research due to its potential roles in cellular processes and disease mechanisms. Specifically, this protein is believed to be involved in various biological functions, including signal transduction, transcriptional regulation, and the modulation of protein interactions. Studies suggest that ANKRD37 may play a crucial role in cell proliferation and differentiation, potentially influencing cancer progression and other pathological conditions. Understanding the structure and function of ANKRD37 is essential to elucidate its mechanisms in disease contexts. Furthermore, the production of recombinant ANKRD37 protein enables detailed studies of its biochemical properties and interactions with other cellular components, facilitating the discovery of potential therapeutic targets. As the disease landscape evolves, investigating the implications of ANKRD37 serves as a promising avenue for advancing our knowledge of molecular biology and developing innovative treatment strategies.
