Cat: PA1000-3169

Recombinant Human TFB1M Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TFB1M

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TFB1M;Dimethyladenosine transferase 1. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WVM0

  • Expression Region

    28-346aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMQAAKQLSQNFLLDLRLTDKIVRKAGNLTN AYVYEVGPGPGGITRSIL NADVAELLVVEKDTRFIPGLQMLSDAAPGK LRIVHGDVLTFKVEKAFSESLKRPWEDDPPNVHIIGNLPFSVSTP LII KWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMAQY LCNVRHIFTIPGQAFVPKPEVD VGVVHFTPLIQPKIEQPFKLVEKVVQ NVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISH FKSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYRL

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TFB1M, or Transcription Factor B1M, is a crucial mitochondrial transcription factor that plays a significant role in the regulation of mitochondrial gene expression. It is involved in the assembly of the mitochondrial transcription initiation complex, which is essential for the transcription of mitochondrial DNA (mtDNA). The study of TFB1M has garnered attention due to its potential implications in various diseases, particularly those associated with mitochondrial dysfunction, such as neurodegenerative disorders, cancer, and metabolic syndromes. Researchers have been focusing on the structural and functional characterization of TFB1M to better understand its mechanism of action in mitochondrial transcription regulation. Gaining insights into TFB1M's role could lead to the development of therapeutic strategies aimed at correcting mitochondrial dysfunctions. Additionally, investigations into its interactions with other mitochondrial proteins may provide valuable information about the intricate networks that govern mitochondrial biology. Given the increasing recognition of mitochondria's impact on cellular health and disease, TFB1M stands out as a significant target for research aimed at unraveling the complexities of mitochondrial gene regulation and its broader implications in human health. This research is not only pivotal for basic science but also holds promise for translational applications in therapies for mitochondrial-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US