Analytical Data
-
Gene name
OR6N1
- Application
-
Alternative Names
OR6N1; Olfactory receptor 6N1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGY5
-
Expression Region
1-312 aa
-
AA Sequence
MDTGNWSQVAEFIILGFPHLQGVQIYLFLLLLLIYLMTVLGNLLIFLVVCLDSRLHTPMY HFVSILSFSELGYTAATIPKMLANLLSEKKTISFSGCLLQIYFFHSLGATECYLLTAMAY DRYLAICRPLHYPTLMTPTLCAEIAIGCWLGGLAGPVVEISLISRLPFCGPNRIQHVFCD FPPVLSLACTDTSINVLVDFVINSCKILATFLLILCSYVQIICTVLRIPSAAGKRKAIST CASHFTVVLIFYGSILSMYVQLKKSYSLDYDQALAVVYSVLTPFLNPFIYSLRNKEIKEA VRRQLKRIGILA
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR6N1, a member of the olfactory receptor gene family, is primarily expressed in the human olfactory epithelium and plays a potential role in the sense of smell. As a G protein-coupled receptor (GPCR), OR6N1 is involved in the detection of volatile odorant molecules. Research into OR6N1 has gained traction due to its implications in various biological processes, including neurobiology and evolutionary biology, and its potential use in therapeutic applications. Furthermore, the understanding of the structure-function relationship of OR6N1 could provide insights into how olfactory receptors interact with their ligands and activate downstream signaling pathways. Recent advances in recombinant protein technology enable the production of OR6N1 in heterologous systems, allowing researchers to study its biochemical properties, ligand-binding characteristics, and overall functional significance in a controlled environment. Investigating OR6N1 through recombinant protein studies may shed light on the mechanisms of olfactory signaling and contribute to the development of novel strategies for addressing olfactory disorders and enhancing sensory perception. The study of OR6N1 is not only crucial for understanding the complexities of the olfactory system but also has potential applications in designing biosensors and understanding the evolutionary adaptations of odor perception across species.
