Analytical Data
-
Gene name
TFB2M
- Application
-
Alternative Names
TFB2M；NS5ATP5；Dimethyladenosine transferase 2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H5Q4
-
Expression Region
20-396aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAGRFCILGSEAATRKHLPARNHCGLS DSSPQLWPEPDFRNPPRKASKASLDFKRYVTDRRLAETLAQIYLGKPSRP PHLLLECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLR VIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKVVGMF PSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPD LYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQK LYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPL DARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED R
-
Molecular Weight
46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TFB2M, or Transcription Factor B2 Mitochondrial, is a key protein involved in the transcription regulation of mitochondrial DNA. As a vital component of the mitochondrial transcription machinery, TFB2M plays a significant role in the maintenance of mitochondrial function, which is essential for cellular metabolism and energy production. The study of TFB2M is crucial due to its direct implications in mitochondrial biogenesis and the regulation of gene expression within mitochondria. Dysfunction in mitochondrial proteins, including TFB2M, has been linked to a range of diseases, such as mitochondrial myopathies, neurodegenerative disorders, and certain types of cancer. Research has shown that TFB2M interacts with other mitochondrial transcription factors and is important for the initiation of transcription by RNA polymerase, ultimately influencing the synthesis of mitochondrial proteins that are critical for oxidative phosphorylation. Given the increasing recognition of the importance of mitochondrial health in overall cellular function and the development of various diseases, understanding the molecular mechanisms of TFB2M and its regulatory pathways has become a pivotal area of investigation. Recent advances in biotechnology and structural biology have enabled researchers to elucidate the functional dynamics of TFB2M, paving the way for potential therapeutic strategies that target mitochondrial dysfunction. By enhancing our knowledge of TFB2M and its role in cellular energy metabolism, the field aims to develop novel interventions for diseases rooted in mitochondrial impairment.
