Analytical Data
-
Gene name
ANKRD36
- Application
-
Alternative Names
ANKRD36; ANKRD36A; KIAA1641; UNQ2430/PRO499; Ankyrin repeat domain-containing Protein 36A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6QL64
-
Expression Region
1-163aa
-
AA Sequence
MEDGKRERWPTLMERLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKV
-
Molecular Weight
45.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANKRD36, a member of the ankyrin repeat domain-containing protein family, has gained attention due to its potential role in various cellular processes and disease mechanisms. Recent studies have indicated that ANKRD36 may be involved in signaling pathways associated with immunity, cell proliferation, and apoptosis. Its unique structure, characterized by multiple ankyrin repeat domains, suggests a potential function in protein-protein interactions that could influence cellular behavior. Research has shown that alterations in ANKRD36 expression levels may correlate with certain pathological conditions, including cancer and autoimmune disorders. Additionally, the protein's involvement in modulating inflammatory responses positions it as a possible target for therapeutic interventions. Understanding the functional dynamics of ANKRD36, particularly through recombinant protein studies, can elucidate its biological roles and pave the way for developing novel strategies to combat diseases linked to its dysregulation. Given its emerging significance, continued exploration of ANKRD36 at the molecular level is vital for clarifying its contribution to health and disease.
