Analytical Data
-
Gene name
OR5B3
- Application
-
Alternative Names
OR5B3; OR5B13; Olfactory receptor 5B3; Olfactory receptor 5B13; Olfactory receptor OR11-239
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH48
-
Expression Region
1-314 aa
-
AA Sequence
MENKTEVTQFILLGLTNDSELQVPLFITFPFIYIITLVGNLGIIVLIFWDSCLHNPMYFF LSNLSLVDFCYSSAVTPIVMAGFLIEDKVISYNACAAQMYIFVAFATVENYLLASMAYDR YAAVCKPLHYTTTMTTTVCARLAIGSYLCGFLNASIHTGDTFSLSFCKSNEVHHFFCDIP AVMVLSCSDRHISELVLIYVVSFNIFIALLVILISYTFIFITILKMHSASVYQKPLSTCA SHFIAVGIFYGTIIFMYLQPSSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFK KVVEKAKLSVGWSV
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5B3, a member of the olfactory receptor family, is a G-protein coupled receptor (GPCR) primarily expressed in the olfactory epithelium, responsible for detecting specific odorant molecules. Research into OR5B3 has gained significance due to its potential implications in various physiological and neurological processes, including the modulation of olfactory perception and its involvement in the sensation of taste. Interestingly, recent studies have linked OR5B3 to specific behavioral responses and preferences, contributing to our understanding of how olfactory cues influence decision-making and social interactions. Furthermore, mutations or variations in the OR5B3 gene have been associated with alterations in olfactory function, highlighting its relevance in conditions such as smell disorders. The development of recombinant OR5B3 proteins allows for detailed studies on its structure, ligand-binding capabilities, and signaling pathways, offering insights into how this receptor contributes to olfactory signaling. Additionally, the use of OR5B3 in pharmacological studies presents potential therapeutic avenues to treat sensory deficits. As the field of sensory biology expands, understanding the role of OR5B3 through recombinant proteins will aid not only in elucidating olfactory mechanisms but also in exploring broader implications for human health and sensory disorders.
