Analytical Data
-
Gene name
OR5B21
- Application
-
Alternative Names
OR5B21; Olfactory receptor 5B21
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NL26
-
Expression Region
1-309 aa
-
AA Sequence
MENSTEVTEFILLGLTDDPNLQIPLLLAFLFIYLITLLGNGGMMVIIHSDSHLHTPMYFF LSNLSLVDLGYSSAVAPKTVAALRSGDKAISYDGCAAQFFFFVGFATVECYLLASMAYDR HAAVCRPLHYTTTMTAGVCALLATGSYVSGFLNASIHAAGTFRLSFCGSNEINHFFCDIP PLLALSCSDTRISKLVVFVAGFNVFFTLLVILISYFFICITIQRMHSAEGQKKVFSTCAS HLTALSIFYGTIIFMYLQPNSSQSVDTDKIASVFYTVVIPMLNPLIYSLRNKEVKSALWK ILNKLYPQY
-
Molecular Weight
34.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5B21 gene encodes a member of the olfactory receptor (OR) family, which plays a crucial role in the detection of odorants, contributing to the sense of smell in mammals. These G-protein coupled receptors are primarily located in the olfactory epithelium and are responsible for initiating the signaling cascade that allows for the perception of various odors. The unique structure and function of OR5B21, as with other olfactory receptors, make it a subject of interest for researchers aiming to understand olfactory mechanisms, scent recognition, and receptor activation. Additionally, studies on OR5B21 have implications for neurobiology, as the olfactory system is closely linked to memory and emotion. However, the functional characterization of OR5B21 has been limited due to challenges in expressing and purifying the protein in recombinant systems. Recent advancements in protein engineering and expression technologies have opened new avenues for the study of OR5B21, enabling researchers to explore its ligand-binding properties, downstream signaling pathways, and potential involvement in olfactory-related disorders. By elucidating the functional characteristics of OR5B21, researchers hope to contribute valuable insights into the broader field of olfactory receptor biology and its relevance to human health.
