Analytical Data
-
Gene name
AMY1B
- Application
-
Alternative Names
AMY1B; AMYC; Os01g0357400; LOC_Os01g25510; P0025H06.22
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DTE7
-
Expression Region
16-511aa
-
AA Sequence
QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
-
Molecular Weight
81.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AMY1B, a member of the amylase gene family, plays a critical role in carbohydrate digestion by catalyzing the hydrolysis of starch into simpler sugars. The gene coding for AMY1B is predominantly expressed in the pancreas and salivary glands, highlighting its significance in both digestive processes and metabolic regulation. Recent studies have explored the genetic variations of AMY1B, revealing that differences in copy number variations can influence amylase expression levels and, consequently, starch digestion efficiency among populations. Given the increasing prevalence of carbohydrate-rich diets worldwide, research on AMY1B recombinant proteins has gained traction, aiming to better understand its functional properties and potential applications in food science and health. By producing AMY1B as a recombinant protein, researchers can investigate its enzymatic activity, structural characteristics, and interactions with various substrates. Additionally, this research holds promise for developing therapeutic strategies for metabolic disorders related to carbohydrate digestion, as well as enhancing the nutritional value of food products through the modulation of amylase activity. Overall, the study of AMY1B recombinant protein is pivotal in advancing our knowledge of carbohydrate metabolism and its implications for human health.
