Analytical Data
-
Gene name
OR5AN1
- Application
-
Alternative Names
OR5AN1; Olfactory receptor 5AN1; Olfactory receptor OR11-244
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGI8
-
Expression Region
1-311 aa
-
AA Sequence
MTGGGNITEITYFILLGFSDFPRIIKVLFTIFLVIYITSLAWNLSLIVLIRMDSHLHTPM YFFLSNLSFIDVCYISSTVPKMLSNLLQEQQTITFVGCIIQYFIFSTMGLSESCLMTAMA YDRYAAICNPLLYSSIMSPTLCVWMVLGAYMTGLTASLFQIGALLQLHFCGSNVIRHFFC DMPQLLILSCTDTFFVQVMTAILTMFFGIASALVIMISYGYIGISIMKITSAKGRSKAFN TCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD ALKRLQKRKCC
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5AN1 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sensory perception of smell. Recent studies have highlighted the importance of olfactory receptors beyond traditional sensory functions; they are involved in various physiological processes, including immune response and neuroprotection. This has spurred interest in OR5AN1 and its potential implications in both health and disease. Recombinant proteins of OR5AN1 are being researched for their structure-function relationships, particularly how they interact with ligands and participate in signal transduction pathways. Understanding these mechanisms can provide insights into the roles of olfactory receptors in non-sensory tissues and could lead to novel therapeutic approaches in treating conditions linked to dysregulated receptor activity or in developing biosensors for detecting specific odors. Given the evolutionary conservation of olfactory receptor genes, OR5AN1 also presents an opportunity to explore wider evolutionary patterns and adaptations within the OR gene family. The study of its recombinant protein may reveal unique features that facilitate specific ligand interactions and downstream signaling, enhancing our understanding of olfactory biology and opening avenues for biotechnological applications. As researchers continue to delve into the complexities of OR5AN1 and other olfactory receptors, they may uncover transformative insights into their broader biological significance and functional versatility.
