Analytical Data
-
Gene name
AMMECR1
- Application
-
Alternative Names
AMERL_HUMAN; AMME chromosomal region gene 1-like; AMMECR1-like; AMMECR1-like Protein; Ammecr1l
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6DCA0
-
Expression Region
1-296aa
-
AA Sequence
MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS
-
Molecular Weight
57.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AMMECR1, or the "Autosomal-Mediate Microdeletion and Encephalopathy-related Protein 1," is a gene implicated in several neurological disorders and developmental anomalies. Research has highlighted the significance of AMMECR1 in cellular processes like apoptosis and neurogenesis, linking it to autism spectrum disorders and intellectual disabilities. As the protein encoded by AMMECR1 plays a crucial role in the central nervous system's development and function, understanding its structure and function through recombinant technology becomes imperative. By producing AMMECR1 as a recombinant protein, researchers aim to investigate its biochemical properties, interactions with other cellular proteins, and its potential pathogenic mechanisms in neurodevelopmental disorders. The generation of this protein can facilitate the development of therapeutic strategies, provide insights into the molecular basis of related diseases, and contribute to biomarker identification for early diagnosis. With advancements in protein engineering and expression systems, AMMECR1 recombinant protein studies can enhance our understanding of its role in health and disease, paving the way for novel interventions in conditions associated with its dysregulation.
