Analytical Data
-
Gene name
OR5A1
- Application
-
Alternative Names
OR5A1; OR5A1P; Olfactory receptor 5A1; OST181; Olfactory receptor OR11-249
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGJ0
-
Expression Region
1-315 aa
-
AA Sequence
MSITKAWNSSSVTMFILLGFTDHPELQALLFVTFLGIYLTTLAWNLALIFLIRGDTHLHT PMYFFLSNLSFIDICYSSAVAPNMLTDFFWEQKTISFVGCAAQFFFFVGMGLSECLLLTA MAYDRYAAISSPLLYPTIMTQGLCTRMVVGAYVGGFLSSLIQASSIFRLHFCGPNIINHF FCDLPPVLALSCSDTFLSQVVNFLVVVTVGGTSFLQLLISYGYIVSAVLKIPSAEGRWKA CNTCASHLMVVTLLFGTALFVYLRPSSSYLLGRDKVVSVFYSLVIPMLNPLIYSLRNKEI KDALWKVLERKKVFS
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5A1, a member of the olfactory receptor (OR) family, has garnered significant interest in research due to its unique role in the sensory perception of smell. This receptor is predominantly expressed in the olfactory epithelium and is involved in the detection of specific volatile compounds, which plays a crucial role in odorant recognition and perception. The study of OR5A1 is particularly relevant because it may contribute to understanding olfactory dysfunctions, which can impact quality of life and indicate various neurological conditions. Furthermore, the recombinant expression of OR5A1 in heterologous systems allows for detailed functional studies, making it possible to elucidate its ligand specificity and downstream signaling mechanisms. Research in this area is pivotal for the development of novel fragrance and flavor compounds and for exploring potential therapeutic targets for olfactory disorders. As the field of olfactory science expands, understanding the structure-function relationship of OR5A1 through methodologies like site-directed mutagenesis and ligand-binding assays will provide insights that bridge the gap between molecular biology and sensory science. Thus, OR5A1 serves as an invaluable model for studying sensory receptors and their significant impact on human behavior and health.
