Cat: PA1000-3128

Recombinant Human TALDO1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TALDO1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TALDO1;TAL;Transaldolase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P37837

  • Expression Region

    1-337aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSSSPVKRQRMESALDQLKQFTTVVADTGD FHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQI KNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYK EAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAE AGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYK TIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQ ASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLTERM FNAENGK

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TALDO1, or transaldolase 1, is a crucial enzyme involved in the pentose phosphate pathway (PPP), playing a key role in cellular metabolism by facilitating the interconversion of sugar phosphates. This enzyme is critical for maintaining cellular redox balance and producing ribose-5-phosphate, which is essential for nucleotide synthesis. Abnormalities in TALDO1 function can lead to various metabolic disorders, including a rare condition known as TALDO1 deficiency, characterized by a range of symptoms, including neurodevelopmental issues and hematological disorders. Recent research has focused on characterizing the recombinant form of TALDO1 to better understand its structural and functional properties, as well as to explore potential therapeutic interventions for TALDO1-related conditions. By producing and analyzing recombinant TALDO1, scientists aim to elucidate the molecular mechanisms underlying its enzymatic activity and stability while also investigating the effects of mutations associated with TALDO1 deficiency. This research is expected to provide insights into the enzyme's role in human metabolism and could pave the way for developing targeted therapies to address metabolic diseases linked to TALDO1 dysfunction. Overall, recombinant TALDO1 studies contribute significantly to the field of metabolic research, enhancing our understanding of enzymatic functions and their implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US