Analytical Data
-
Gene name
OR56B4
- Application
-
Alternative Names
OR56B4; Olfactory receptor 56B4; Olfactory receptor OR11-67
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH76
-
Expression Region
1-319 aa
-
AA Sequence
MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETV LHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGI FLCMAVDRYIAICRPLQYPSIVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEI EHCLCSNLGVISLACDDITVNKFYQLMLAWVLVGSDMALVFSSYAVILHSVLRLNSAEAM SKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFLNVLHNVIPPALNPLACALRM HKLRLGFQRLLGLGQDVSK
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR56B4 is a member of the olfactory receptor family, which plays a critical role in the sensory perception of smells. This family consists of a diverse array of G protein-coupled receptors (GPCRs) that mediate olfactory signal transduction in the olfactory epithelium. The study of OR56B4 is vital due to its potential implications in understanding the mechanisms of odor detection and the molecular pathways involved in olfaction. Recent research has highlighted the importance of olfactory receptors beyond the olfactory system, linking them to various physiological processes, including neurogenesis and immune responses. Despite its relevance, the specific ligand(s) for OR56B4 and the receptor's overall biological function remain largely uncharacterized, making it an intriguing target for further investigation. Scientists are increasingly utilizing advanced molecular biology techniques, such as recombinant protein expression and functional assays, to elucidate the receptor's properties and interactions. By expressing OR56B4 as a recombinant protein, researchers aim to characterize its ligand-binding characteristics and signaling capabilities, contributing to a deeper understanding of olfactory receptor biology and its broader implications for health and disease. This research could pave the way for novel therapeutic strategies aimed at modulating olfactory pathways, thereby offering potential avenues for treating olfactory dysfunction and related disorders.
