Analytical Data
-
Gene name
TAGLN3
- Application
-
Alternative Names
TAGLN3;NP25;Transgelin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UI15
-
Expression Region
1-199aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQKYDADLENKL VDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKI SESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLM ALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS NKGASQAGMTGYGMPRQIM
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAGLN3 (Transgelin-3), a member of the transgelin family of proteins, has garnered increasing attention in recent years due to its potential roles in cellular processes and disease states. Initially identified as a smooth muscle protein, TAGLN3 is involved in the regulation of actin dynamics, cell motility, and the maintenance of cellular structure. Research has shown that TAGLN3 expression levels can vary significantly in different tissues and pathological conditions, suggesting a role in processes such as tumorigenesis and inflammatory responses. Studies indicate that TAGLN3 may contribute to the modulation of cell signaling pathways and interact with other cytoskeletal proteins. Furthermore, aberrations in TAGLN3 expression have been linked to various malignancies, prompting investigations into its potential as a biomarker for cancer diagnosis and prognosis. The recombinant production of TAGLN3 facilitates detailed studies of its biochemical properties and functional roles, paving the way for deeper insights into its mechanistic involvement in health and disease. Understanding TAGLN3's function at the molecular level could reveal new therapeutic targets and strategies for managing diseases associated with its dysregulation. Thus, the research on TAGLN3 and its recombinant protein forms is pivotal for elucidating its contributions to cellular behavior and disease pathology, offering promising avenues for future studies.











