Analytical Data
-
Gene name
OR56B1
- Application
-
Alternative Names
OR56B1; OR56B1P; Olfactory receptor 56B1; Olfactory receptor OR11-65
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGI3
-
Expression Region
1-324 aa
-
AA Sequence
MNHMSASLKISNSSKFQVSEFILLGFPGIHSWQHWLSLPLALLYLSALAANTLILIIIWQ NPSLQQPMYIFLGILCMVDMGLATTIIPKILAIFWFDAKVISLPECFAQIYAIHFFVGME SGILLCMAFDRYVAICHPLRYPSIVTSSLILKATLFMVLRNGLFVTPVPVLAAQRDYCSK NEIEHCLCSNLGVTSLACDDRRPNSICQLVLAWLGMGSDLSLIILSYILILYSVLRLNSA EAAAKALSTCSSHLTLILFFYTIVVVISVTHLTEMKATLIPVLLNVLHNIIPPSLNPTVY ALQTKELRAAFQKVLFALTKEIRS
-
Molecular Weight
36.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR56B1 is a member of the olfactory receptor (OR) family, which plays a crucial role in the sensory perception of smell. The study of OR56B1, specifically its recombinant protein, has garnered attention due to its potential implications in understanding olfactory signaling pathways and the mechanisms underlying odor detection. Olfactory receptors, as G protein-coupled receptors (GPCRs), are expressed in the sensory neurons of the nasal epithelium and are responsible for detecting a wide range of volatile compounds. However, the function of many ORs, including OR56B1, remains largely unexplored, making them interesting targets for biochemical and structural studies. Recent advances in recombinant DNA technology enable the expression and purification of OR proteins, allowing researchers to investigate their pharmacological properties, ligand interactions, and structural conformations. Such studies can elucidate how specific receptors contribute to the discrimination of odors and the overall complexity of olfactory perception. Additionally, understanding OR56B1's role could have broader implications in fields like neurobiology and pharmacology, potentially leading to applications in designing odorant-based therapies and understanding olfactory dysfunctions. Overall, research on OR56B1 recombinant protein could shed light on the intricate workings of the olfactory system and how it influences behavior and physiology.
