Cat: PA2000-5359

Recombinant Human ADAMTS17 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAMTS17

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADAM-TS 17; ADAM-TS17; ADAMTS 17; ADAMTS-17; ADAMTS17

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8TE56

  • Expression Region

    543-650aa

  • AA Sequence

    DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD

  • Molecular Weight

    37.62 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAMTS17 (A Disintegrin And Metalloproteinase with Thrombospondin Motifs 17) is a member of the ADAMTS family, known for its role in extracellular matrix (ECM) remodeling and its involvement in various pathological processes. Recent research has highlighted its significance in connective tissue disorders, particularly in skeletal development and disease. Mutations in the ADAMTS17 gene have been linked to a range of heritable connective tissue disorders, including a unique form of skeletal dysplasia characterized by unusually short stature and skeletal abnormalities. The recombinant protein of ADAMTS17 has become a focal point of research due to its potential therapeutic applications and as a tool for understanding the molecular mechanisms underlying its functions in ECM dynamics. Studies utilizing the recombinant form of ADAMTS17 aim to elucidate its enzymatic activity, substrate specificity, and interactions with other proteins within the ECM. Additionally, the investigation of ADAMTS17 in various tissue types can provide insights into its role in normal physiology and disease states, thereby advancing our understanding of connective tissue biology and offering avenues for targeted interventions in related conditions. Overall, the exploration of ADAMTS17 through recombinant protein studies holds promise for unveiling new therapeutic strategies for managing connective tissue disorders and enhancing our comprehension of ECM biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US