Cat: PA1000-2986

Recombinant Human SNX5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SNX5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNX5;Sorting nexin-5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y5X3

  • Expression Region

    1-404aa

  • AA Sequence

    MASMTGGQQMGRGEFMAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDI PDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDY AGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAV FKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGG FFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTR SHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSS DEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKD VKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIK HARNNVSLLQSCIDLFKNN

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SNX5 (Sorting Nexin 5) is a member of the sorting nexin family, which plays a crucial role in intracellular trafficking and membrane dynamics. Research has shown that SNX5 is involved in various cellular processes, including endocytosis, autophagy, and the sorting of membrane proteins. Its function is particularly significant in the context of immune responses and cellular signaling pathways. Abnormalities in SNX5 expression or function have been implicated in several diseases, including cancer and neurodegenerative disorders. Given its pivotal role in cellular processes, studying recombinant SNX5 proteins has become essential for understanding the mechanisms underlying its function and regulation. Researchers aim to express and purify SNX5 proteins to investigate their structural properties and interactions with other cellular components. This research is critical for elucidating its biological roles and discovering potential therapeutic targets, as manipulating SNX5 activity could pave the way for novel treatments in conditions where its functionality is disrupted. Through advanced techniques such as crystallography and biophysical assays, insights gained from these studies will contribute significantly to the broader knowledge of membrane trafficking and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US