Analytical Data
-
Gene name
OR10X1
- Application
-
Alternative Names
OR10X1; OR10X1P; Olfactory receptor 10X1; Olfactory receptor OR1-14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGY0
-
Expression Region
1-326 aa
-
AA Sequence
MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCLYLLTLAGNLI IMGLTWVDRSLHTPMYLFLSALSFSETCYTLTIVPKMLEDLLAKDRSISVTGCSLQMCFF LGLGGTNCIILTLMGYDRFLAICNPLRYPLLMTNIVCGQLVASACTAGFFISLTETALIF RDSFCRPNLVKHFFCHMLAVIRLSCIDSNHTEFIITLISVSGLLGTLLLIILTDVFIIST VLRIPSAEGKQKAFTTCASHLTVVIIHFGFASIVYLKPEASGDDTLIAVPYTVITPFLSP IIFSLRNKDMKNAFRRMMGNTVALKK
-
Molecular Weight
36.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR10X1 is a member of the olfactory receptor gene family, which plays a critical role in the detection of odorants in the olfactory system. Recent studies have indicated that OR10X1 is not only implicated in olfactory transduction but may also have functions beyond traditional sensory roles, such as involvement in various physiological and pathological processes. Researchers have become increasingly interested in investigating the potential therapeutic applications of OR10X1, particularly in diseases where olfactory dysfunction is evident. The ability to express and purify recombinant OR10X1 protein has opened new avenues for understanding its structural and functional characteristics. This recombinant protein can be utilized in various biochemical assays and interaction studies, shedding light on the mechanisms of receptor activation and signal transduction pathways. Furthermore, exploring the ligand specificity and binding kinetics of OR10X1 could provide valuable insights into its role in sensory biology and its potential as a biomarker for certain health conditions. The growing interest in utilizing olfactory receptors in drug discovery highlights the importance of characterizing OR10X1, as understanding its function could lead to novel approaches in developing treatments for sensory disorders and beyond. Overall, the research surrounding OR10X1 recombinant protein underscores the importance of olfactory receptors in both health and disease, paving the way for innovative therapeutic strategies.











