Analytical Data
-
Gene name
RGS17
- Application
-
Alternative Names
RGS17;RGSZ2;Regulator of G-Protein signaling 17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGC6
-
Expression Region
1-210aa
-
AA Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
-
Molecular Weight
51.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RGS17 (Regulator of G protein Signaling 17) is a member of the RGS protein family, which plays a crucial role in modulating G protein-coupled receptor (GPCR) signaling pathways. These pathways are essential for various physiological processes, including neurotransmission, hormone release, and cellular responses to external stimuli. RGS proteins act as GTPase-activating proteins (GAPs), accelerating the hydrolysis of GTP on Gα subunits and thus terminating signaling. Recent studies have indicated that RGS17 is not only involved in standard GPCR signaling but also has implications in cancer biology, particularly in certain types of tumors where its expression levels can influence cancer cell proliferation and survival. Understanding the structure and function of recombinant RGS17 proteins could provide critical insights into its specific regulatory mechanisms and interactions with GPCRs, potentially revealing novel therapeutic targets. The production of RGS17 as a recombinant protein allows researchers to investigate its biochemical properties and functional roles in signaling pathways, paving the way for advances in drug discovery and therapeutic interventions for diseases linked to dysregulated G protein signaling. Given the increasing recognition of the importance of RGS proteins in health and disease, RGS17 offers an intriguing area of research that may contribute to our understanding of GPCR-related diseases and the development of targeted therapies.
