Analytical Data
-
Gene name
ND4
- Application
-
Alternative Names
NADH-ubiquinone oxidoreductase chain 4. EC:7.1.1.2. NADH dehydrogenase subunit 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03905
-
Expression Region
406-459 aa
-
AA Sequence
YSLYIFTTTQWGSLTHHINNIKPSFTRENTLMFIHLSPILLLSLNPDIITGFSS
-
Molecular Weight
31.68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ND4 recombinant protein is derived from the mitochondrial ND4 gene, which encodes a vital subunit of the NADH dehydrogenase complex I, a crucial component of the mitochondrial electron transport chain. This protein plays a significant role in cellular respiration and energy production. Research on ND4 recombinant protein is primarily motivated by its implications in mitochondrial diseases, where mutations in the ND4 gene are associated with various pathologies, including Leber's Hereditary Optic Neuropathy (LHON) and other neurodegenerative disorders. Understanding the structure, function, and implications of ND4 can aid in elucidating the mechanisms behind these diseases and developing therapeutic strategies. Additionally, the production of ND4 as a recombinant protein allows for detailed studies of its biochemical properties and interactions within the respiratory chain, paving the way for potential interventions targeting mitochondrial dysfunction. Advances in protein expression systems and purification techniques have facilitated the generation and analysis of ND4 recombinant protein, enhancing our ability to explore its role in health and disease.
