Analytical Data
-
Gene name
GSDMA
- Application
-
Alternative Names
GSDMA；GSDM；GSDM1；Gasdermin-A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96QA5
-
Expression Region
1-445aa
-
AA Sequence
MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS
-
Molecular Weight
49.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GSDMA (Gasdermin A) is a member of the gasdermin protein family, which plays a crucial role in regulating programmed cell death, inflammation, and immune responses. Research into GSDMA has garnered significant attention due to its unique mechanism of action, involving the formation of pores in cell membranes that can lead to pyroptosis, a form of inflammatory cell death. Dysregulation of GSDMA has been implicated in various diseases, including certain cancers and autoimmune disorders. The study of GSDMA recombinant proteins provides valuable insights into their structure-function relationships and potential therapeutic applications. By producing GSDMA in a recombinant form, researchers can investigate its biochemical properties, interactions with other cellular components, and its role in disease pathogenesis. Such studies can also facilitate the development of targeted therapies aimed at modulating its activity in disease contexts. Understanding the functional impact of GSDMA and its signaling pathways may contribute to novel treatment strategies that harness or inhibit its effects in relevant pathological conditions. Overall, the exploration of GSDMA recombinant proteins is a promising area of research that holds potential for advancing our knowledge of cell death mechanisms and their implications for health and disease.
