Analytical Data
-
Gene name
MSS51
- Application
-
Alternative Names
Putative protein MSS51 homolog. mitochondrial. Zinc finger MYND domain-containing protein 17
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q4VC12
-
Expression Region
1-460 aa
-
AA Sequence
MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQLILQKLNMKSYEEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKVLRHCKRCRNVYYCGPECQKSDWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWPPEAVQDWDSWFSMKGLHLDATLDAVLVSHAVTTLWASVGRPRPDPDVLQGSLKRLLTDVLSRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRPGDYDELGYMFPGHLGLRVVMVGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAVGSNPFMSLKPEQVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI
-
Molecular Weight
77.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MSS51 is a crucial recombinant protein that has garnered attention in the field of molecular biology due to its role in mitochondrial translation and cell metabolism. Initially identified in yeast, it has been acknowledged for its potential involvement in the assembly of mitochondrial ribosomes and regulation of mitochondrial gene expression. The study of MSS51 is particularly relevant as mitochondrial dysfunction is implicated in various human diseases, including neurodegenerative disorders and metabolic syndromes. By exploring the structure and function of MSS51, researchers aim to elucidate its mechanisms at the molecular level, which could pave the way for developing therapeutic strategies targeting mitochondrial-related diseases. Furthermore, the production of MSS51 as a recombinant protein allows for in-depth studies regarding its interactions with other mitochondrial components, offering insights into mitochondrial biogenesis and protein synthesis. This understanding is vital as it may unlock new avenues for research in bioenergetics and contribute to the development of treatments for conditions stemming from mitochondrial dysfunction. Overall, the investigation of MSS51 not only enhances our comprehension of mitochondrial biology but also holds promise for future medical advancements.
