Cat: PA1000-2594

Recombinant Human PYCR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PYCR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PYCR1;Pyrroline-5-carboxylate reductase 1. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P32322

  • Expression Region

    1-319aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSVGFIGAGQLAFALAKGFTAAGVLAAHKI MASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILD EIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVRE GATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDN VSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKD

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PYCR1, or pyrroline-5-carboxylate reductase 1, is an enzyme that plays a crucial role in the proline biosynthetic pathway, which is essential for maintaining cellular homeostasis, particularly under stress conditions. Research has indicated that PYCR1 is involved in the conversion of pyrroline-5-carboxylate to proline, an amino acid that serves as an important osmoprotectant, antioxidant, and regulator of cellular signaling. Dysregulation of PYCR1 has been linked to various pathological conditions, including metabolic disorders, neurodegenerative diseases, and cancer, highlighting its significance in cellular health and disease. The study of recombinant PYCR1 protein has gained traction as it provides insights into its biochemical properties, functional mechanisms, and potential therapeutic applications. Understanding the structure-function relationship of PYCR1 at a molecular level can unveil targets for drug development and interventions in related diseases. Moreover, recombinant PYCR1 can serve as a valuable tool in metabolic engineering and synthetic biology, allowing for the manipulation of proline metabolism in various organisms. Investigating this protein can therefore contribute to a broader understanding of metabolic pathways and their implications in health and disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US