Analytical Data
-
Gene name
PDRG1
- Application
-
Alternative Names
PDRG1;C20orf126;PDRG;p53 and DNA damage-regulated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUG6
-
Expression Region
1-133aa
-
AA Sequence
MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
-
Molecular Weight
31.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDRG1 (P53 and DRG1) has emerged as a significant focus of research due to its dual role in cellular processes, particularly in cancer biology. It is a gene that is upregulated in various tumors and has been linked to the regulation of cell proliferation, differentiation, and apoptosis. The protein encoded by PDRG1 is believed to play a role in the response to stress and DNA damage, particularly through interactions with the p53 tumor suppressor pathway. Studies have shown that PDRG1 might contribute to cancer progression by influencing cell survival and proliferation in response to oncogenic signals. Despite its potential as a biomarker for cancer diagnosis and prognosis, the precise molecular mechanisms of PDRG1 remain largely unclear. Additionally, its role in other physiological processes and diseases underscores the need for further research. Recombinant PDRG1 protein studies aim to elucidate its structure-function relationship and interactions with cellular partners, paving the way for the development of targeted therapies. Understanding PDRG1's biological functions could lead to new insights into tumorigenesis and provide novel strategies for cancer treatment. As such, the recombinant expression and characterization of PDRG1 are crucial in uncovering its roles in health and disease.











