Analytical Data
-
Gene name
SKAP1
- Application
-
Alternative Names
SKAP1；SCAP1；SKAP55；Src kinase-associated phosphoProtein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WV1
-
Expression Region
1-358aa
-
AA Sequence
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEE
-
Molecular Weight
57.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SKAP1 (Src Kinase-Associated Protein 1) is an adapter protein that plays a crucial role in the signaling pathways of immune cells, particularly in T cells and natural killer (NK) cells. It is involved in connecting various signaling molecules, facilitating the transmission of signals triggered by antigen receptor engagement and cytokine stimulation, thereby influencing immune responses. The study of SKAP1 recombinant proteins has gained significant attention due to its potential implications in understanding immune cell activation and differentiation. Dysregulation of SKAP1 has been linked to various diseases, including autoimmune disorders and cancer, making it a critical target for therapeutic interventions. Additionally, the recombination of SKAP1 enables the detailed examination of its structural and functional characteristics, providing insights into its role in cellular signaling networks. Researchers utilize recombinant SKAP1 to investigate its interaction with other proteins, assess its impact on T cell receptor signaling, and elucidate its contribution to immune system functioning. The characterization of SKAP1 through recombinant technology not only enhances our comprehension of its physiological roles but also aids in the development of novel strategies for immune modulation in clinical settings.
