Analytical Data
-
Gene name
PPP1R3G
- Application
-
Alternative Names
PPP1R3G；Protein phosphatase 1 regulatory subunit 3G
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B7ZBB8
-
Expression Region
1-358aa
-
AA Sequence
MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQEELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGLSLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAAERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAPSGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRYARPADAL
-
Molecular Weight
45.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1R3G, a member of the PPP1R3 family, plays a crucial role in regulating protein phosphatase 1 (PP1) activity, which is essential for various cellular processes including glycogen metabolism, cell division, and signal transduction. The interest in PPP1R3G has surged due to its key functions in glucose homeostasis and its potential implications in metabolic disorders, particularly diabetes and obesity. Research has shown that alterations in the expression or function of PPP1R3G can significantly impact insulin signaling and glycogen synthesis. Furthermore, the protein's interactions with other signaling molecules highlight its importance in cellular response mechanisms. Recombinant PPP1R3G has become a valuable tool for investigating these pathways, allowing researchers to elucidate its precise contributions to cellular functions and its potential role in disease mechanisms. By producing and characterizing this recombinant protein, studies aim to uncover the molecular underpinnings of its activity and explore novel therapeutic strategies targeting PPP1R3G-related pathways for metabolic diseases.
