Cat: PA2000-4109

Recombinant E.coli hmfA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    hmfA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    hmfA;DNA-binding Protein HMf-1

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48781

  • Expression Region

    1-69aa

  • AA Sequence

    MGELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMFK

  • Molecular Weight

    14.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HmfA (Hemolysin-encoding factor A) is a significant protein found in certain bacterial species, particularly those associated with pathogenicity. The study of HmfA is crucial due to its role in the virulence mechanisms of bacteria, where it contributes to the formation of pores in host cell membranes, facilitating pathogen invasion and evasion of the immune response. Research on HmfA recombinant proteins has gained attention as they can serve as valuable tools for understanding the molecular interactions between pathogens and host cells. Additionally, the potential application of HmfA in vaccine development and therapeutic avenues makes it an area of intense investigation. Scientists are employing advanced techniques such as genetic engineering and structural biology to elucidate the functional properties of HmfA and its interactions with host immune components. Furthermore, understanding the evolution and expression regulation of HmfA can provide insights into bacterial adaptability and resistance mechanisms. As antibiotic resistance becomes a growing concern, characterizing the functionality and properties of HmfA may inform the design of novel antimicrobial strategies. This research not only aims to deepen the comprehension of bacterial pathogenesis but also holds promise for public health by contributing to the development of innovative treatment methods and preventive measures against bacterial infections linked to HmfA-expressing organisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US