Analytical Data
-
Gene name
GLUL
- Application
-
Alternative Names
GLUL;GLNS;Glutamine synthetase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15104
-
Expression Region
2-373aa
-
AA Sequence
TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
-
Molecular Weight
48.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLUL, or glutamine synthetase, is a critical enzyme that catalyzes the synthesis of glutamine from glutamate and ammonia, playing an essential role in nitrogen metabolism and neurotransmitter regulation in both prokaryotic and eukaryotic organisms. The study of GLUL recombinant proteins has gained significance due to their potential applications in biotechnology and medicine. Understanding the structure and function of GLUL can provide insights into its role in various physiological processes, including cellular signaling, immune response, and metabolism. Recent advancements in molecular biology techniques, such as CRISPR gene editing and advanced protein expression systems, have facilitated the production of high-purity GLUL recombinant proteins for in-depth studies. Researchers aim to explore the enzyme's regulatory mechanisms, its interactions with different substrates, and its implications in diseases such as cancer and neurodegenerative disorders. By producing GLUL in a recombinant form, scientists can generate specific antibodies, study enzyme kinetics, and investigate potential therapeutic applications. Furthermore, the insights gained from GLUL research could lead to innovative strategies for manipulating glutamine metabolism in various clinical settings, making it a focal point of research in metabolic engineering and drug development. Overall, the recombinant production of GLUL represents a promising avenue toward unraveling the complexities of nitrogen metabolism and the development of novel therapeutic interventions.











