Analytical Data
-
Gene name
PTHR2
- Application
-
Alternative Names
PTHR2；PTHR2；Parathyroid hormone 2 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49190
-
Expression Region
27-145aa
-
AA Sequence
DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY
-
Molecular Weight
29.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTHR2, or Parathyroid Hormone Receptor 2, is a G-protein coupled receptor (GPCR) closely related to the regulation of calcium and phosphate homeostasis in the body. Its primary function is to mediate the biological effects of parathyroid hormone and parathyroid hormone-related peptide, making it a crucial player in skeletal health and mineral metabolism. Research into PTHR2 has gained momentum due to its potential implications in bone disorders, such as osteoporosis and the regulation of energy metabolism. Given the receptor's involvement in various physiological processes, including cell proliferation, survival, and differentiation, the development of recombinant PTHR2 proteins becomes essential for studying its structure-function relationships. These recombinant proteins allow researchers to explore the receptor's signaling pathways, pharmacological properties, and interactions with ligands, offering insights into therapeutic targets for diseases related to calcium imbalance. Moreover, understanding the molecular mechanisms underlying PTHR2 function could lead to innovative treatment strategies for bone-related diseases and metabolic disorders, emphasizing the receptor's significance in both basic and clinical research.
