Analytical Data
-
Gene name
Orm1
- Application
-
Alternative Names
Orm1；ORM1-like Protein 3
-
Species
Rat
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02764
-
Expression Region
19-205aa
-
AA Sequence
QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
-
Molecular Weight
25.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Orm1, or ORM1 (Orosomucoid 1), is a highly glycosylated plasma protein primarily synthesized by the liver and classified as an acute-phase reactant. It has garnered significant attention in biomedical research due to its involvement in various physiological and pathological processes, including immune response, inflammation, and tissue repair. The protein is known to exhibit immunomodulatory effects, potentially influencing the outcome of diseases such as cancer, autoimmune disorders, and infectious diseases. Moreover, elevated levels of Orm1 have been associated with inflammatory conditions and certain malignancies, making it a potential biomarker for disease states. The study of recombinant Orm1 protein offers valuable insights into its structural properties, functional roles, and interactions with other biomolecules. By expressing Orm1 in heterologous systems, researchers can obtain large quantities of pure protein for detailed investigation, including its role in modulating human immune responses. Understanding the mechanisms through which Orm1 functions may open new avenues for therapeutic interventions and diagnostic applications. Overall, the research on Orm1 recombinant protein continues to enhance our knowledge of its biological significance and potential clinical implications, underscoring its importance in the context of health and disease.
