Analytical Data
-
Gene name
TGFbR1
- Application
-
Alternative Names
TGFbR1;TGF-beta receptor type-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36897
-
Expression Region
34-126aa
-
AA Sequence
LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
-
Molecular Weight
17.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Transforming growth factor-beta receptor 1 (TGFbR1) plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis, making it a significant focus of research in the fields of cancer, fibrosis, and autoimmune diseases. Dysregulation of TGFbR1 signaling has been implicated in multiple pathological conditions, such as tumor progression and metastasis, where it can function both as a tumor suppressor and a promoter depending on the context. The receptor is a part of the TGF-beta superfamily, which comprises several growth factors with overlapping functions. Understanding the structural and functional aspects of TGFbR1 is essential for developing therapeutic interventions targeting its pathway. Recombinant TGFbR1 protein has been utilized to elucidate the mechanisms of TGF-beta signaling, enabling researchers to explore its interactions with ligands and downstream signaling molecules. Studies involving TGFbR1 have also facilitated the identification of potential biomarkers for disease prognosis and therapeutic response. Given its pivotal role, the recombinant form of TGFbR1 provides a valuable tool for both basic and applied research, paving the way for novel strategies to modulate its activity in clinical settings.











