Cat: PA1000-1266

Recombinant Human GLRX Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLRX

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLRX;GRX;Glutaredoxin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35754

  • Expression Region

    1-106aa

  • AA Sequence

    MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

  • Molecular Weight

    38.8kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLRX, or Glutaredoxin, is a crucial member of the thioredoxin superfamily and plays a significant role in maintaining cellular redox balance by catalyzing the reduction of oxidized proteins and protecting cells from oxidative stress. The interest in recombinant GLRX protein has surged due to its implications in various biological processes, including cellular signaling, apoptosis, and the regulation of cellular metabolism. Abnormal GLRX expression has been linked to several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases, making it a potential biomarker and therapeutic target. Research into recombinant GLRX focuses on the protein's structure and function to better understand its mechanisms and interactions within the cell. Furthermore, producing GLRX in a recombinant form allows for extensive studies on its enzymatic activities, potential inhibitors, and its role in redox biology, paving the way for novel therapeutic approaches. Advances in biotechnology have enabled the efficient expression and purification of GLRX, facilitating a range of studies that contribute to our understanding of its physiological roles and applications in medicine. As such, the exploration of GLRX through recombinant technology represents an important avenue for improving our knowledge of oxidative stress management and developing therapeutic strategies for redox-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US